Lineage for d6z3kb1 (6z3k B:1-106)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2352459Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2352460Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2365354Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2365355Protein automated matches [190740] (29 species)
    not a true protein
  7. 2365565Species Human (Homo sapiens) [TaxId:9606] [187920] (1626 PDB entries)
  8. 2367511Domain d6z3kb1: 6z3k B:1-106 [393848]
    Other proteins in same PDB: d6z3kb2, d6z3kd2, d6z3kf2, d6z3ki2, d6z3kk2, d6z3kl2, d6z3kn2, d6z3kp2, d6z3kr2
    automated match to d1dn0a1
    complexed with edo

Details for d6z3kb1

PDB Entry: 6z3k (more details), 2.7 Å

PDB Description: structure of protective antibody 38-1-10a fab
PDB Compounds: (B:) light chain

SCOPe Domain Sequences for d6z3kb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6z3kb1 b.1.1.0 (B:1-106) automated matches {Human (Homo sapiens) [TaxId: 9606]}
diqmtqspsslsasvgdrvtitcrasqgirndlgwyqqkpgkapklliyaasslqsgvps
rfsgsgsgtdftltisslqpedfatyyclqdynylltfgggtkvei

SCOPe Domain Coordinates for d6z3kb1:

Click to download the PDB-style file with coordinates for d6z3kb1.
(The format of our PDB-style files is described here.)

Timeline for d6z3kb1: