Lineage for d6z1zb_ (6z1z B:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2352459Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2352460Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2352461Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 2355068Protein automated matches [190119] (22 species)
    not a true protein
  7. 2355831Species Llama (Lama glama) [TaxId:9844] [187485] (223 PDB entries)
  8. 2355881Domain d6z1zb_: 6z1z B: [393824]
    automated match to d1igmh_

Details for d6z1zb_

PDB Entry: 6z1z (more details), 1.7 Å

PDB Description: structure of the anti-cd9 nanobody 4c8
PDB Compounds: (B:) Nanobody 4C8

SCOPe Domain Sequences for d6z1zb_:

Sequence, based on SEQRES records: (download)

>d6z1zb_ b.1.1.1 (B:) automated matches {Llama (Lama glama) [TaxId: 9844]}
evqlvesggglvqaggslrlscaasgrtfsdyvmgwfrqapgkertfvarigwsgdltyy
adsvkgrftisrdnakntvylqmnslkpedtaiyycaaderwgtggkfdywgqgtqvtvs
s

Sequence, based on observed residues (ATOM records): (download)

>d6z1zb_ b.1.1.1 (B:) automated matches {Llama (Lama glama) [TaxId: 9844]}
evqlvesggglvqaggslrlscaasgrtfsdyvmgwfrqapgkertfvarigwsgdltyy
adsvkgrftisrdnakntvylqmnslkpedtaiyycaaderwgkfdywgqgtqvtvss

SCOPe Domain Coordinates for d6z1zb_:

Click to download the PDB-style file with coordinates for d6z1zb_.
(The format of our PDB-style files is described here.)

Timeline for d6z1zb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d6z1za_