SCOPe 2.07: Domain d6z3qb_: 6z3q B:

Lineage for d6z3qb_ (6z3q B:)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.121: Nucleoplasmin-like/VP (viral coat and capsid proteins) [88632] (7 superfamilies)
   sandwich; 8 strands in 2 sheets; jelly-roll; some members can have additional 1-2 strands
   characteristic interaction between the domains of this fold allows the formation of five-fold and pseudo six-fold assemblies

4. Superfamily b.121.4: Positive stranded ssRNA viruses [88633] (10 families)

5. Family b.121.4.0: automated matches [191569] (1 protein)
   not a true family

6. Protein automated matches [190988] (22 species)
   not a true protein

7. Species Enterovirus a71 [TaxId:39054] [261947] (13 PDB entries)

8. Domain d6z3qb_: 6z3q B: [393819]
   Other proteins in same PDB: d6z3qc_, d6z3ql_
   automated match to d3zfeb_
   complexed with sph

Details for d6z3qb_

PDB Entry: 6z3q, 2.7 Å

PDB Description: structure of ev71 in complex with a protective antibody 38-1-10a fab

PDB Compounds: (B:) vp2

SCOPe Domain Sequences for d6z3qb_:

Sequence; same for both SEQRES and ATOM records:

>d6z3qb_ b.121.4.0 (B:) automated matches {Enterovirus a71 [TaxId: 39054]}
sdrvaqltignstittqeaaniivgygewpsycsdddatavdkptrpdvsvnrfytldtk
lweksskgwywkfpdvltetgvfgqnaqfhylyrsgfcihvqcnaskfhqgallvailpe
yvigtvaggtgtedshppyiqtqpgadgfelqhpyvldagipisqltvcphqwinlrtnn
catiivpymntlpfdsalnhcnfgllvvpispldfdqgatpvipititlapmcsefaglr
qavtq

Timeline for d6z3qb_:

• d6z3qb_ is new in SCOPe 2.07-stable
  
• d6z3qb_ appears in the current release, SCOPe 2.08