Lineage for d6yc5a_ (6yc5 A:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2387550Fold b.25: Osmotin, thaumatin-like protein [49869] (1 superfamily)
    sandwich; 11 strands in 2 sheets
  4. 2387551Superfamily b.25.1: Osmotin, thaumatin-like protein [49870] (2 families) (S)
    has two smaller insertion domains
  5. 2387552Family b.25.1.1: Osmotin, thaumatin-like protein [49871] (5 proteins)
    automatically mapped to Pfam PF00314
  6. 2387560Protein Thaumatin [49876] (1 species)
  7. 2387561Species Ketemfe (Thaumatococcus daniellii) [TaxId:4621] [49877] (113 PDB entries)
    Uniprot P02883
  8. 2387585Domain d6yc5a_: 6yc5 A: [393709]
    automated match to d1kwna_
    complexed with na, tla

Details for d6yc5a_

PDB Entry: 6yc5 (more details), 1.35 Å

PDB Description: rt structure of thaumatin obtained at 1.35 a resolution from crystal grown in a kapton microchip.
PDB Compounds: (A:) Thaumatin-1

SCOPe Domain Sequences for d6yc5a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6yc5a_ b.25.1.1 (A:) Thaumatin {Ketemfe (Thaumatococcus daniellii) [TaxId: 4621]}
atfeivnrcsytvwaaaskgdaaldaggrqlnsgeswtinvepgtnggkiwartdcyfdd
sgsgicktgdcggllrckrfgrppttlaefslnqygkdyidisnikgfnvpmnfspttrg
crgvrcaadivgqcpaklkapgggcndactvfqtseyccttgkcgpteysrffkrlcpda
fsyvldkpttvtcpgssnyrvtfcpta

SCOPe Domain Coordinates for d6yc5a_:

Click to download the PDB-style file with coordinates for d6yc5a_.
(The format of our PDB-style files is described here.)

Timeline for d6yc5a_: