Lineage for d6yac1_ (6yac 1:)

  1. Root: SCOPe 2.07
  2. 2626587Class f: Membrane and cell surface proteins and peptides [56835] (60 folds)
  3. 2633630Fold f.43: Chlorophyll a-b binding protein [103510] (1 superfamily)
    membrane all-alpha fold; three transmembrane helices
  4. 2633631Superfamily f.43.1: Chlorophyll a-b binding protein [103511] (2 families) (S)
    duplication: contains two structural repeats
  5. 2633682Family f.43.1.0: automated matches [276197] (1 protein)
    not a true family
  6. 2633683Protein automated matches [276200] (4 species)
    not a true protein
  7. 2633718Species Pea (Pisum sativum) [TaxId:3888] [276203] (9 PDB entries)
  8. 2633723Domain d6yac1_: 6yac 1: [393680]
    Other proteins in same PDB: d6yaca_, d6yacb_, d6yacc_, d6yacd_, d6yace1, d6yace2, d6yacf_, d6yacj_, d6yacn_
    automated match to d5l8r1_
    complexed with bcr, c7z, ca, chl, cl0, cla, dgd, fes, lhg, lmg, lmt, lut, pqn, sf4, xat

Details for d6yac1_

PDB Entry: 6yac (more details), 2.5 Å

PDB Description: plant psi-ferredoxin supercomplex
PDB Compounds: (1:) Lhca1

SCOPe Domain Sequences for d6yac1_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6yac1_ f.43.1.0 (1:) automated matches {Pea (Pisum sativum) [TaxId: 3888]}
dwmpgqprpsyldgsapgdfgfdplrlgevpenlerfkeselihcrwamlavpgilvpea
lglgnwvkaqewaalpggqatylgnpvpwgtlptilvieflsiafvehqrsmekdpekkk
ypggafdplgyskdpkkfheykikevkngrlallafvgicvqqsaypgtgplenlathla
dpwhntignvlip

SCOPe Domain Coordinates for d6yac1_:

Click to download the PDB-style file with coordinates for d6yac1_.
(The format of our PDB-style files is described here.)

Timeline for d6yac1_: