Class f: Membrane and cell surface proteins and peptides [56835] (60 folds) |
Fold f.43: Chlorophyll a-b binding protein [103510] (1 superfamily) membrane all-alpha fold; three transmembrane helices |
Superfamily f.43.1: Chlorophyll a-b binding protein [103511] (2 families) duplication: contains two structural repeats |
Family f.43.1.0: automated matches [276197] (1 protein) not a true family |
Protein automated matches [276200] (4 species) not a true protein |
Species Pea (Pisum sativum) [TaxId:3888] [276203] (9 PDB entries) |
Domain d6yac1_: 6yac 1: [393680] Other proteins in same PDB: d6yaca_, d6yacb_, d6yacc_, d6yacd_, d6yace1, d6yace2, d6yacf_, d6yacj_, d6yacn_ automated match to d5l8r1_ complexed with bcr, c7z, ca, chl, cl0, cla, dgd, fes, lhg, lmg, lmt, lut, pqn, sf4, xat |
PDB Entry: 6yac (more details), 2.5 Å
SCOPe Domain Sequences for d6yac1_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6yac1_ f.43.1.0 (1:) automated matches {Pea (Pisum sativum) [TaxId: 3888]} dwmpgqprpsyldgsapgdfgfdplrlgevpenlerfkeselihcrwamlavpgilvpea lglgnwvkaqewaalpggqatylgnpvpwgtlptilvieflsiafvehqrsmekdpekkk ypggafdplgyskdpkkfheykikevkngrlallafvgicvqqsaypgtgplenlathla dpwhntignvlip
Timeline for d6yac1_: