SCOPe 2.07: Domain d6ydig_: 6ydi G:

Lineage for d6ydig_ (6ydi G:)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.137: Monooxygenase (hydroxylase) regulatory protein [56028] (1 superfamily)
   corner-like structure formed by two sheets and filled in with 2-3 helices

4. Superfamily d.137.1: Monooxygenase (hydroxylase) regulatory protein [56029] (1 family)
   duplication: consists of two beta-alpha-(beta)-beta(2) motifs; some topological similarity to the ferredoxin-like fold

5. Family d.137.1.1: Monooxygenase (hydroxylase) regulatory protein [56030] (4 proteins)
   note: the solution structure determinations disagree in the relative orientations of two motifs

6. Protein automated matches [190214] (3 species)
   not a true protein

7. Species Methylosinus trichosporium [TaxId:595536] [392646] (7 PDB entries)

8. Domain d6ydig_: 6ydi G: [393649]
   Other proteins in same PDB: d6ydib_, d6ydid_, d6ydif_
   automated match to d1ckva_
   complexed with fe2, gol

Details for d6ydig_

PDB Entry: 6ydi, 1.95 Å

PDB Description: xfel structure of the soluble methane monooxygenase hydroxylase and regulatory subunit complex, from methylosinus trichosporium ob3b, diferrous state

PDB Compounds: (G:) Methane monooxygenase regulatory protein B

SCOPe Domain Sequences for d6ydig_:

Sequence; same for both SEQRES and ATOM records:

>d6ydig_ d.137.1.1 (G:) automated matches {Methylosinus trichosporium [TaxId: 595536]}
sahnaynagimqktgkafadeffaeenqvvhesnavvlvlmksdeidaiiedivlkggka
knpsivvedkagfwwikadgaieidaaeagellgkpfsvydllinvsstvgraytlgtkf
titselmgldraltdi

Timeline for d6ydig_:

• d6ydig_ is new in SCOPe 2.07-stable
  
• d6ydig_ appears in the current release, SCOPe 2.08