Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
Fold d.137: Monooxygenase (hydroxylase) regulatory protein [56028] (1 superfamily) corner-like structure formed by two sheets and filled in with 2-3 helices |
Superfamily d.137.1: Monooxygenase (hydroxylase) regulatory protein [56029] (1 family) duplication: consists of two beta-alpha-(beta)-beta(2) motifs; some topological similarity to the ferredoxin-like fold |
Family d.137.1.1: Monooxygenase (hydroxylase) regulatory protein [56030] (4 proteins) note: the solution structure determinations disagree in the relative orientations of two motifs |
Protein automated matches [190214] (3 species) not a true protein |
Species Methylosinus trichosporium [TaxId:595536] [392646] (7 PDB entries) |
Domain d6ydig_: 6ydi G: [393649] Other proteins in same PDB: d6ydib_, d6ydid_, d6ydif_ automated match to d1ckva_ complexed with fe2, gol |
PDB Entry: 6ydi (more details), 1.95 Å
SCOPe Domain Sequences for d6ydig_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6ydig_ d.137.1.1 (G:) automated matches {Methylosinus trichosporium [TaxId: 595536]} sahnaynagimqktgkafadeffaeenqvvhesnavvlvlmksdeidaiiedivlkggka knpsivvedkagfwwikadgaieidaaeagellgkpfsvydllinvsstvgraytlgtkf titselmgldraltdi
Timeline for d6ydig_: