Class b: All beta proteins [48724] (178 folds) |
Fold b.121: Nucleoplasmin-like/VP (viral coat and capsid proteins) [88632] (7 superfamilies) sandwich; 8 strands in 2 sheets; jelly-roll; some members can have additional 1-2 strands characteristic interaction between the domains of this fold allows the formation of five-fold and pseudo six-fold assemblies |
Superfamily b.121.6: Group I dsDNA viruses [88648] (2 families) |
Family b.121.6.0: automated matches [227135] (1 protein) not a true family |
Protein automated matches [226836] (7 species) not a true protein |
Species New jersey polyomavirus-2013 [TaxId:1497391] [389096] (2 PDB entries) |
Domain d6y5yh_: 6y5y H: [393604] automated match to d1vpsb_ complexed with bgc, gal, glc, gol, mg, sia |
PDB Entry: 6y5y (more details), 1.8 Å
SCOPe Domain Sequences for d6y5yh_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6y5yh_ b.121.6.0 (H:) automated matches {New jersey polyomavirus-2013 [TaxId: 1497391]} atteielwleprmgvnaptgdrkewygysevihhadgydnnllsvqmpqyscarvqlpml ntdmtcetlmmweavscktevvgigslisvhlleakmeagpnsdgpsrpiegmnyhmfav ggepldlqgiesngqtkyataipaksihpndiaklpeedkaqlqglvpkakakldkdgfy pveewspdpsrnensryygsfvgglqtppnlqftnavstvlldengvgplckgdglfvsc adicgvlvkadneairyrglpryfkvtlrkravk
Timeline for d6y5yh_: