Lineage for d6y1gb_ (6y1g B:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2546826Fold d.22: GFP-like [54510] (1 superfamily)
    beta-sheet folds into a barrel (n=11, S=14) around the central helix
  4. 2546827Superfamily d.22.1: GFP-like [54511] (3 families) (S)
  5. 2547682Family d.22.1.0: automated matches [191400] (1 protein)
    not a true family
  6. 2547683Protein automated matches [190526] (25 species)
    not a true protein
  7. 2548073Species Heteractis crispa [TaxId:175771] [393550] (1 PDB entry)
  8. 2548075Domain d6y1gb_: 6y1g B: [393551]
    automated match to d5exba_
    complexed with edo

Details for d6y1gb_

PDB Entry: 6y1g (more details), 2.3 Å

PDB Description: photoconverted hcred in its optoacoustic state
PDB Compounds: (B:) GFP-like non-fluorescent chromoprotein

SCOPe Domain Sequences for d6y1gb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6y1gb_ d.22.1.0 (B:) automated matches {Heteractis crispa [TaxId: 175771]}
gllkesmrikmymegtvnghyfkcegegdgnpfagtqsmrihvtegaplpfafdilapcc
esrtfvhhtaeipdffkqsfpegftwertttyedggiltahqdtslegncliykvkvlgt
nfpadgpvmknksggwepstevvypengvlcgrnvmalkvgdrrlichhytsyrskkavr
altmpgfhftdirlqmlrkekdeyfelyeasvarysdlpeka

SCOPe Domain Coordinates for d6y1gb_:

Click to download the PDB-style file with coordinates for d6y1gb_.
(The format of our PDB-style files is described here.)

Timeline for d6y1gb_: