Lineage for d6y11c_ (6y11 C:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2484063Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 2484064Superfamily c.47.1: Thioredoxin-like [52833] (24 families) (S)
  5. 2486826Family c.47.1.21: NQO2-like [142405] (2 proteins)
    complex I 24 kDa subunit; contains 2Fe-2S cluster in the active site; includes extra N-terminal four-helical bundle
    automatically mapped to Pfam PF01257
  6. 2486833Protein automated matches [254686] (2 species)
    not a true protein
  7. 2486843Species Thermus thermophilus [TaxId:274] [393521] (1 PDB entry)
  8. 2486845Domain d6y11c_: 6y11 C: [393522]
    Other proteins in same PDB: d6y1111, d6y1112, d6y1113, d6y1131, d6y1132, d6y1133, d6y1134, d6y114_, d6y115_, d6y116_, d6y117_, d6y11b1, d6y11b2, d6y11b3, d6y11d1, d6y11d2, d6y11d3, d6y11d4, d6y11e_, d6y11f_, d6y11g_, d6y11i_, d6y11w_, d6y11x_
    automated match to d3iam2_
    complexed with fes, fmn, sf4

Details for d6y11c_

PDB Entry: 6y11 (more details), 3.11 Å

PDB Description: respiratory complex i from thermus thermophilus
PDB Compounds: (C:) NADH-quinone oxidoreductase subunit 2

SCOPe Domain Sequences for d6y11c_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6y11c_ c.47.1.21 (C:) automated matches {Thermus thermophilus [TaxId: 274]}
ffddkqdfleetfakyppegrraaimpllrrvqqeegwirperieeiarlvgttptevmg
vasfysyyqfvptgkyhlqvcatlscklagaeelwdyltetlgigpgevtpdglfsvqkv
eclgschtapviqvndepyvecvtrarleallaglragkrleeielpgkcghhvheve

SCOPe Domain Coordinates for d6y11c_:

Click to download the PDB-style file with coordinates for d6y11c_.
(The format of our PDB-style files is described here.)

Timeline for d6y11c_: