Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.47: Thioredoxin fold [52832] (2 superfamilies) core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest |
Superfamily c.47.1: Thioredoxin-like [52833] (24 families) |
Family c.47.1.21: NQO2-like [142405] (2 proteins) complex I 24 kDa subunit; contains 2Fe-2S cluster in the active site; includes extra N-terminal four-helical bundle automatically mapped to Pfam PF01257 |
Protein automated matches [254686] (2 species) not a true protein |
Species Thermus thermophilus [TaxId:274] [393521] (1 PDB entry) |
Domain d6y11c_: 6y11 C: [393522] Other proteins in same PDB: d6y1111, d6y1112, d6y1113, d6y1131, d6y1132, d6y1133, d6y1134, d6y114_, d6y115_, d6y116_, d6y117_, d6y11b1, d6y11b2, d6y11b3, d6y11d1, d6y11d2, d6y11d3, d6y11d4, d6y11e_, d6y11f_, d6y11g_, d6y11i_, d6y11w_, d6y11x_ automated match to d3iam2_ complexed with fes, fmn, sf4 |
PDB Entry: 6y11 (more details), 3.11 Å
SCOPe Domain Sequences for d6y11c_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6y11c_ c.47.1.21 (C:) automated matches {Thermus thermophilus [TaxId: 274]} ffddkqdfleetfakyppegrraaimpllrrvqqeegwirperieeiarlvgttptevmg vasfysyyqfvptgkyhlqvcatlscklagaeelwdyltetlgigpgevtpdglfsvqkv eclgschtapviqvndepyvecvtrarleallaglragkrleeielpgkcghhvheve
Timeline for d6y11c_: