SCOPe 2.07: Domain d6y1ml1: 6y1m L:2-110

Lineage for d6y1ml1 (6y1m L:2-110)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (29 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187920] (1626 PDB entries)

8. Domain d6y1ml1: 6y1m L:2-110 [393498]
   automated match to d5adpl1
   complexed with dep; mutant

Details for d6y1ml1

PDB Entry: 6y1m, 2 Å

PDB Description: crystal structure of the paraoxon-modified a.17 antibody fab fragment - l47k mutant

PDB Compounds: (L:) FAB A.17 L47K mutant Light Chain

SCOPe Domain Sequences for d6y1ml1:

Sequence; same for both SEQRES and ATOM records:

>d6y1ml1 b.1.1.0 (L:2-110) automated matches {Human (Homo sapiens) [TaxId: 9606]}
svltqppsvsaapgqkvtiscsgsssnignnyvswyqqlpgtapkkliydnnkrpsgipd
rfsgsksgtsatlgitglqtgdeadyycgtwdsslnpvfgggtkleikr

Timeline for d6y1ml1:

• d6y1ml1 is new in SCOPe 2.07-stable
  
• d6y1ml1 appears in the current release, SCOPe 2.08