Lineage for d6xnba_ (6xnb A:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2449371Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2449372Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2454167Family c.2.1.0: automated matches [191313] (1 protein)
    not a true family
  6. 2454168Protein automated matches [190069] (309 species)
    not a true protein
  7. 2455838Species Leifsonia xyli [TaxId:1575] [393366] (1 PDB entry)
  8. 2455839Domain d6xnba_: 6xnb A: [393367]
    automated match to d5u9pc_
    complexed with mg; mutant

Details for d6xnba_

PDB Entry: 6xnb (more details), 1.16 Å

PDB Description: the crystal structure of the s154y mutant carbonyl reductase from leifsonia xyli explains enhanced activity for 3,5- bis(trifluoromethyl)acetophenone reduction
PDB Compounds: (A:) Short chain alcohol dehydrogenase

SCOPe Domain Sequences for d6xnba_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6xnba_ c.2.1.0 (A:) automated matches {Leifsonia xyli [TaxId: 1575]}
maqydvagrsaivtgggsgigraialtlaasgaavlvtdlneenanavvaeisaaggtar
alagdvtdpafaeasvaaanelaplriavnnagiggaaapvgdypldswrkvievnlnav
fygmqaqldaigangggaivnmasilgsvgfanysayvtakhallgltqnaaleyagknv
rvvavgpgfirtplvasnmdadtlaflegkhalgrlgepeevaslvaflasdaasfitgs
yhlvdggytaq

SCOPe Domain Coordinates for d6xnba_:

Click to download the PDB-style file with coordinates for d6xnba_.
(The format of our PDB-style files is described here.)

Timeline for d6xnba_: