Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456 The nucleotide-binding modes of this and the next two folds/superfamilies are similar |
Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) |
Family c.2.1.0: automated matches [191313] (1 protein) not a true family |
Protein automated matches [190069] (309 species) not a true protein |
Species Leifsonia xyli [TaxId:1575] [393366] (1 PDB entry) |
Domain d6xnba_: 6xnb A: [393367] automated match to d5u9pc_ complexed with mg; mutant |
PDB Entry: 6xnb (more details), 1.16 Å
SCOPe Domain Sequences for d6xnba_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6xnba_ c.2.1.0 (A:) automated matches {Leifsonia xyli [TaxId: 1575]} maqydvagrsaivtgggsgigraialtlaasgaavlvtdlneenanavvaeisaaggtar alagdvtdpafaeasvaaanelaplriavnnagiggaaapvgdypldswrkvievnlnav fygmqaqldaigangggaivnmasilgsvgfanysayvtakhallgltqnaaleyagknv rvvavgpgfirtplvasnmdadtlaflegkhalgrlgepeevaslvaflasdaasfitgs yhlvdggytaq
Timeline for d6xnba_: