SCOPe 2.07: Domain d6xnpa1: 6xnp A:155-336

Lineage for d6xnpa1 (6xnp A:155-336)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.387: STING C-terminal-like [254119] (1 superfamily)
   5 helices and 5 strands in one mixed beta-sheet, one long bent helix

4. Superfamily d.387.1: STING, TM173 CTD-like [254144] (2 families)
   Pfam PF15009, PubMed 22579474

5. Family d.387.1.1: Tyrosinase cofactor MelC1 [254191] (2 proteins)

6. Protein Tyrosinase cofactor MelC1 [254420] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [254863] (47 PDB entries)

8. Domain d6xnpa1: 6xnp A:155-336 [393320]
   Other proteins in same PDB: d6xnpa2, d6xnpb2
   automated match to d4f5wa_
   complexed with edo, gol, v67

Details for d6xnpa1

PDB Entry: 6xnp, 1.77 Å

PDB Description: crystal structure of human sting ctd complex with sr-717

PDB Compounds: (A:) Stimulator of interferon protein

SCOPe Domain Sequences for d6xnpa1:

Sequence, based on SEQRES records:

>d6xnpa1 d.387.1.1 (A:155-336) Tyrosinase cofactor MelC1 {Human (Homo sapiens) [TaxId: 9606]}
vahglawsyyigylrlilpelqarirtynqhynnllrgavsqrlyillpldcgvpdnlsm
adpnirfldklpqqtgdragikdrvysnsiyellengqragtcvleyatplqtlfamsqy
sqagfsredrleqaklfcrtlediladapesqnncrliayqepaddssfslsqevlrhlr
qe

Sequence, based on observed residues (ATOM records):

>d6xnpa1 d.387.1.1 (A:155-336) Tyrosinase cofactor MelC1 {Human (Homo sapiens) [TaxId: 9606]}
vahglawsyyigylrlilpelqarirtynqhynnllrgavsqrlyillpldcgvpdnlsm
adpnirfldklpqqtgdragikdrvysnsiyellengqragtcvleyatplqtlfamsqy
sgfsredrleqaklfcrtlediladapesqnncrliayqepfslsqevlrhlrqe

Timeline for d6xnpa1:

• d6xnpa1 is new in SCOPe 2.07-stable
  
• d6xnpa1 appears in the current release, SCOPe 2.08