Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.82: ALDH-like [53719] (1 superfamily) consists of two similar domains with 3 layers (a/b/a) each; duplication core: parallel beta-sheet of 5 strands, order 32145 |
Superfamily c.82.1: ALDH-like [53720] (3 families) binds NAD differently from other NAD(P)-dependent oxidoreductases |
Family c.82.1.0: automated matches [191448] (1 protein) not a true family |
Protein automated matches [190683] (59 species) not a true protein |
Species Pseudomonas syringae [TaxId:223283] [340448] (5 PDB entries) |
Domain d6x9lb_: 6x9l B: [393297] automated match to d1o9ja_ complexed with nad, oya; mutant |
PDB Entry: 6x9l (more details), 2.52 Å
SCOPe Domain Sequences for d6x9lb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6x9lb_ c.82.1.0 (B:) automated matches {Pseudomonas syringae [TaxId: 223283]} lnshrvdphtaqkfyidghwsaplspvsiavvnpateevvahvasgsaadvdravaaara afagwsgtspevraqvigriheliierkeelaqaislemgaaissaramqvplaaehvrv ardllatyrfqtveggtaierepigvcalitpwnwplyqitakvapaiaagctvvlkpse lsplsallfaqlvhdaglppgvfnlvngsgpevggamaahpdidmisitgsnragalvaq aaaptvkrvtqelggkspnillpdadfanavppgvmaafrnvgqsasaptrmivprnrla evealaaqtagtivvgdpqlehtvlgpianeaqfhrvqaminagicegaklvcggpgrvq gheqgfytrptvfsevdssmriareeifgpvlcliaydtideavaiandtvyglgahvqg qdlelarsvasriragqvhlnypswnpmapfggykrsgngreygvhgfeeyletkaivgf apad
Timeline for d6x9lb_: