Lineage for d6xbzi2 (6xbz I:162-284)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2331190Fold a.74: Cyclin-like [47953] (1 superfamily)
    core: 5 helices; one helix is surrounded by the others
  4. 2331191Superfamily a.74.1: Cyclin-like [47954] (4 families) (S)
    duplication: consists of two domains of this fold
  5. 2331192Family a.74.1.1: Cyclin [47955] (9 proteins)
  6. 2331672Protein automated matches [227027] (3 species)
    not a true protein
  7. 2331702Species Human (Homo sapiens) [TaxId:9606] [225840] (19 PDB entries)
  8. 2331734Domain d6xbzi2: 6xbz I:162-284 [393294]
    Other proteins in same PDB: d6xbzj_
    automated match to d1jkwa2
    complexed with ags, mg

Details for d6xbzi2

PDB Entry: 6xbz (more details), 2.8 Å

PDB Description: structure of the human cdk-activating kinase
PDB Compounds: (I:) Cyclin-H

SCOPe Domain Sequences for d6xbzi2:

Sequence; same for both SEQRES and ATOM records: (download)

>d6xbzi2 a.74.1.1 (I:162-284) automated matches {Human (Homo sapiens) [TaxId: 9606]}
npyrpfegflidlktrypilenpeilrktaddflnrialtdayllytpsqialtailssa
sragitmesylseslmlkenrtclsqlldimksmrnlvkkyepprseevavlkqklerch
sae

SCOPe Domain Coordinates for d6xbzi2:

Click to download the PDB-style file with coordinates for d6xbzi2.
(The format of our PDB-style files is described here.)

Timeline for d6xbzi2:

View in 3D
Domains from same chain:
(mouse over for more information)
d6xbzi1
View in 3D
Domains from other chains:
(mouse over for more information)
d6xbzj_