Class a: All alpha proteins [46456] (289 folds) |
Fold a.74: Cyclin-like [47953] (1 superfamily) core: 5 helices; one helix is surrounded by the others |
Superfamily a.74.1: Cyclin-like [47954] (4 families) duplication: consists of two domains of this fold |
Family a.74.1.1: Cyclin [47955] (9 proteins) |
Protein automated matches [227027] (3 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [225840] (19 PDB entries) |
Domain d6xbzi2: 6xbz I:162-284 [393294] Other proteins in same PDB: d6xbzj_ automated match to d1jkwa2 complexed with ags, mg |
PDB Entry: 6xbz (more details), 2.8 Å
SCOPe Domain Sequences for d6xbzi2:
Sequence; same for both SEQRES and ATOM records: (download)
>d6xbzi2 a.74.1.1 (I:162-284) automated matches {Human (Homo sapiens) [TaxId: 9606]} npyrpfegflidlktrypilenpeilrktaddflnrialtdayllytpsqialtailssa sragitmesylseslmlkenrtclsqlldimksmrnlvkkyepprseevavlkqklerch sae
Timeline for d6xbzi2: