Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.72: Ribokinase-like [53612] (3 superfamilies) core: 3 layers: a/b/a; mixed beta-sheet of 8 strands, order 21345678, strand 7 is antiparallel to the rest potential superfamily: members of this fold have similar functions but different ATP-binding sites |
Superfamily c.72.2: MurD-like peptide ligases, catalytic domain [53623] (3 families) has extra strand located between strands 1 and 2 |
Family c.72.2.0: automated matches [254328] (1 protein) not a true family |
Protein automated matches [254749] (4 species) not a true protein |
Species Pseudomonas aeruginosa, PA01 [TaxId:208964] [271624] (6 PDB entries) |
Domain d6x9fg2: 6x9f G:97-311 [393251] Other proteins in same PDB: d6x9fa1, d6x9fa3, d6x9fb1, d6x9fb3, d6x9fc1, d6x9fc3, d6x9fd1, d6x9fd3, d6x9fe1, d6x9fe3, d6x9ff1, d6x9ff3, d6x9fg1, d6x9fg3, d6x9fh1, d6x9fh3 automated match to d4hv4a2 complexed with cl, dms, edo, uxp |
PDB Entry: 6x9f (more details), 2.35 Å
SCOPe Domain Sequences for d6x9fg2:
Sequence; same for both SEQRES and ATOM records: (download)
>d6x9fg2 c.72.2.0 (G:97-311) automated matches {Pseudomonas aeruginosa, PA01 [TaxId: 208964]} raemlaelmryrhgiavagthgkttttsliasvfaaggldptfviggrlnaagtnaqlga srylvaeadesdasflhlqpmvavvtnidadhmatyggdfnklkktfveflhnlpfygla vmcvddpvvreilpqiarptvtyglsedadvrainirqegmrtwftvlrperepldvsvn mpglhnvlnslativiatdegisdeaivqglsgfq
Timeline for d6x9fg2: