SCOPe 2.07: Domain d6x3si_: 6x3s I:

Lineage for d6x3si_ (6x3s I:)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (29 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [188198] (822 PDB entries)

8. Domain d6x3si_: 6x3s I: [393183]
   automated match to d1igml_
   complexed with j94, man, nag

Details for d6x3si_

PDB Entry: 6x3s, 3.12 Å

PDB Description: human gabaa receptor alpha1-beta2-gamma2 subtype in complex with bicuculline methbromide

PDB Compounds: (I:) Kappa Fab Light Chain

SCOPe Domain Sequences for d6x3si_:

Sequence; same for both SEQRES and ATOM records:

>d6x3si_ b.1.1.0 (I:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
nivmtqspksmsmsvgervtlsckaseyvgtyvswyqqkpeqspklliygasnrytgvpd
rftgsgsatdftltigsvqaedladyhcgqsysyptfgagtklel

Timeline for d6x3si_:

• d6x3si_ is new in SCOPe 2.07-stable
  
• d6x3si_ appears in the current release, SCOPe 2.08