Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.47: Thioredoxin fold [52832] (2 superfamilies) core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest |
Superfamily c.47.1: Thioredoxin-like [52833] (24 families) |
Family c.47.1.0: automated matches [191312] (1 protein) not a true family |
Protein automated matches [190056] (188 species) not a true protein |
Species Nicotiana alata [TaxId:4087] [393155] (1 PDB entry) |
Domain d6x0bb_: 6x0b B: [393167] automated match to d1wmja_ complexed with edo |
PDB Entry: 6x0b (more details), 1.7 Å
SCOPe Domain Sequences for d6x0bb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6x0bb_ c.47.1.0 (B:) automated matches {Nicotiana alata [TaxId: 4087]} gsssepsrviafhssnrwqlhfnsskqlnklivvdfaatwcgpckmmepvinamsakytd vdfvkidvdelsdvaqefgvqamptflllkqgkevervvgakkdelekkilkhre
Timeline for d6x0bb_: