SCOPe 2.07: Domain d6x0bb_: 6x0b B:

Lineage for d6x0bb_ (6x0b B:)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
   core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest

4. Superfamily c.47.1: Thioredoxin-like [52833] (24 families)

5. Family c.47.1.0: automated matches [191312] (1 protein)
   not a true family

6. Protein automated matches [190056] (188 species)
   not a true protein

7. Species Nicotiana alata [TaxId:4087] [393155] (1 PDB entry)

8. Domain d6x0bb_: 6x0b B: [393167]
   automated match to d1wmja_
   complexed with edo

Details for d6x0bb_

PDB Entry: 6x0b, 1.7 Å

PDB Description: crystal structure of thioredoxin natrxh from nicotiana alata

PDB Compounds: (B:) thioredoxin H

SCOPe Domain Sequences for d6x0bb_:

Sequence; same for both SEQRES and ATOM records:

>d6x0bb_ c.47.1.0 (B:) automated matches {Nicotiana alata [TaxId: 4087]}
gsssepsrviafhssnrwqlhfnsskqlnklivvdfaatwcgpckmmepvinamsakytd
vdfvkidvdelsdvaqefgvqamptflllkqgkevervvgakkdelekkilkhre

Timeline for d6x0bb_:

• d6x0bb_ is new in SCOPe 2.07-stable
  
• d6x0bb_ appears in the current release, SCOPe 2.08