Lineage for d1fjgf_ (1fjg F:)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 723373Fold d.58: Ferredoxin-like [54861] (55 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 725083Superfamily d.58.14: Ribosomal protein S6 [54995] (1 family) (S)
  5. 725084Family d.58.14.1: Ribosomal protein S6 [54996] (1 protein)
  6. 725085Protein Ribosomal protein S6 [54997] (2 species)
  7. 725088Species Thermus thermophilus [TaxId:274] [54998] (42 PDB entries)
  8. 725107Domain d1fjgf_: 1fjg F: [39316]
    Other proteins in same PDB: d1fjgb_, d1fjgc1, d1fjgc2, d1fjgd_, d1fjge1, d1fjge2, d1fjgg_, d1fjgh_, d1fjgi_, d1fjgj_, d1fjgk_, d1fjgl_, d1fjgm_, d1fjgn_, d1fjgo_, d1fjgp_, d1fjgq_, d1fjgr_, d1fjgs_, d1fjgt_, d1fjgv_
    complexed with mg, par, scm, sry, zn

Details for d1fjgf_

PDB Entry: 1fjg (more details), 3 Å

PDB Description: structure of the thermus thermophilus 30s ribosomal subunit in complex with the antibiotics streptomycin, spectinomycin, and paromomycin
PDB Compounds: (F:) 30S ribosomal protein S6

SCOP Domain Sequences for d1fjgf_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fjgf_ d.58.14.1 (F:) Ribosomal protein S6 {Thermus thermophilus [TaxId: 274]}
mrryevnivlnpnldqsqlalekeiiqralenygarvekveelglrrlaypiakdpqgyf
lwyqvempedrvndlarelrirdnvrrvmvvksqepflana

SCOP Domain Coordinates for d1fjgf_:

Click to download the PDB-style file with coordinates for d1fjgf_.
(The format of our PDB-style files is described here.)

Timeline for d1fjgf_: