SCOPe 2.07: Domain d6wz1b_: 6wz1 B:

Lineage for d6wz1b_ (6wz1 B:)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.24: Four-helical up-and-down bundle [47161] (28 superfamilies)
   core: 4 helices; bundle, closed or partly opened, left-handed twist; up-and-down

4. Superfamily a.24.3: Cytochromes [47175] (3 families)
   Heme-containing proteins

5. Family a.24.3.1: Cytochrome b562 [47176] (2 proteins)
   automatically mapped to Pfam PF07361

6. Protein Cytochrome b562 [47177] (1 species)

7. Species Escherichia coli [TaxId:562] [47178] (63 PDB entries)

8. Domain d6wz1b_: 6wz1 B: [393135]
   automated match to d3de8a_
   complexed with ca, cl, hec, mn

Details for d6wz1b_

PDB Entry: 6wz1, 2 Å

PDB Description: mn-bound structure of an engineered protein trimer, tricyt3

PDB Compounds: (B:) Soluble cytochrome b562

SCOPe Domain Sequences for d6wz1b_:

Sequence; same for both SEQRES and ATOM records:

>d6wz1b_ a.24.3.1 (B:) Cytochrome b562 {Escherichia coli [TaxId: 562]}
adlednmetlndnlkviekadnaaqvkdalkkmrkaaldakkatppkledkspaspemid
frvgfdelaweihdaahlakegkvkeaqaaaeqlkttcnachqkyr

Timeline for d6wz1b_:

• d6wz1b_ is new in SCOPe 2.07-stable
  
• d6wz1b_ appears in the current release, SCOPe 2.08