Lineage for d6wslf1 (6wsl F:1-243)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2471420Fold c.32: Tubulin nucleotide-binding domain-like [52489] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456
  4. 2471421Superfamily c.32.1: Tubulin nucleotide-binding domain-like [52490] (2 families) (S)
    automatically mapped to Pfam PF00091
  5. 2471422Family c.32.1.1: Tubulin, GTPase domain [52491] (4 proteins)
  6. 2471549Protein automated matches [226837] (10 species)
    not a true protein
  7. 2472098Species Homo sapiens [TaxId:9606] [393072] (1 PDB entry)
  8. 2472101Domain d6wslf1: 6wsl F:1-243 [393079]
    Other proteins in same PDB: d6wsla2, d6wslb2, d6wsle2, d6wslf2
    automated match to d5bmvb1
    complexed with g2p, gtp

Details for d6wslf1

PDB Entry: 6wsl (more details), 3.1 Å

PDB Description: cryo-em structure of vash1-svbp bound to microtubules
PDB Compounds: (F:) Tubulin beta-3 chain

SCOPe Domain Sequences for d6wslf1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6wslf1 c.32.1.1 (F:1-243) automated matches {Homo sapiens [TaxId: 9606]}
mreivhiqagqcgnqigakfwevisdehgidpsgnyvgdsdlqlerisvyyneasshkyv
prailvdlepgtmdsvrsgafghlfrpdnfifgqsgagnnwakghytegaelvdsvldvv
rkecencdclqgfqlthslgggtgsgmgtlliskvreeypdrimntfsvvpspkvsdtvv
epynatlsihqlventdetycidnealydicfrtlklatptygdlnhlvsatmsgvttsl
rfp

SCOPe Domain Coordinates for d6wslf1:

Click to download the PDB-style file with coordinates for d6wslf1.
(The format of our PDB-style files is described here.)

Timeline for d6wslf1: