Class b: All beta proteins [48724] (178 folds) |
Fold b.60: Lipocalins [50813] (1 superfamily) barrel, closed or opened; n=8, S=12; meander |
Superfamily b.60.1: Lipocalins [50814] (10 families) bind hydrophobic ligands in their interior |
Family b.60.1.2: Fatty acid binding protein-like [50847] (18 proteins) ten-stranded meander beta-sheet folded upon itself relates to the common fold by opening the barrel and insertion of beta-hairpin |
Protein automated matches [190295] (7 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [187133] (101 PDB entries) |
Domain d6wp2c_: 6wp2 C: [393038] automated match to d5u6ga_ complexed with act, gol, zn |
PDB Entry: 6wp2 (more details), 2.48 Å
SCOPe Domain Sequences for d6wp2c_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6wp2c_ b.60.1.2 (C:) automated matches {Human (Homo sapiens) [TaxId: 9606]} trdfngtwemesnenfegymkaldidfatrkiavrltftdvidqdgdnfktkatsthlny dvdftvgvefdeytksldnrhvkalvtwegdvlvcvqkgekenrgwkkwiegdklylelt cgdqvcrqvfkkk
Timeline for d6wp2c_: