Lineage for d6wo5i1 (6wo5 I:1-106)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2352459Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2352460Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2365354Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2365355Protein automated matches [190740] (29 species)
    not a true protein
  7. 2365565Species Human (Homo sapiens) [TaxId:9606] [187920] (1626 PDB entries)
  8. 2367595Domain d6wo5i1: 6wo5 I:1-106 [393028]
    Other proteins in same PDB: d6wo5b2, d6wo5d2, d6wo5i2, d6wo5l2
    automated match to d1dn0a1
    complexed with bma, nag

Details for d6wo5i1

PDB Entry: 6wo5 (more details), 2.62 Å

PDB Description: structure of hepatitis c virus envelope glycoprotein e2 core from genotype 1a bound to neutralizing antibody 212.1.1 and non neutralizing antibody e1
PDB Compounds: (I:) Fab 212.1.1 light chain

SCOPe Domain Sequences for d6wo5i1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6wo5i1 b.1.1.0 (I:1-106) automated matches {Human (Homo sapiens) [TaxId: 9606]}
diqmtqspsslsasvgdrvtitcrasqgisnylawyqqkpgkvpklliyaastlqsgvps
rfsgsgygteftltisslqpedvatyycqqhdnlpltfgggtkvei

SCOPe Domain Coordinates for d6wo5i1:

Click to download the PDB-style file with coordinates for d6wo5i1.
(The format of our PDB-style files is described here.)

Timeline for d6wo5i1: