SCOPe 2.07: Domain d6wkcb_: 6wkc B:

Lineage for d6wkcb_ (6wkc B:)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.128: Terpenoid synthases [48575] (1 superfamily)
   multihelical; core: 8 helices (C-J) are arranged in 2 parallel layers

4. Superfamily a.128.1: Terpenoid synthases [48576] (6 families)
   duplication: two metal-binding sites are related by a pseudo dyad that also relates helices C-F to helices G-J

5. Family a.128.1.4: Aristolochene/pentalenene synthase [48586] (3 proteins)

6. Protein Pentalenene synthase [48589] (1 species)

7. Species Streptomyces sp., UC5319 [TaxId:1931] [48590] (11 PDB entries)

8. Domain d6wkcb_: 6wkc B: [393005]
   automated match to d1ps1a_
   complexed with mg

Details for d6wkcb_

PDB Entry: 6wkc, 1.65 Å

PDB Description: crystal structure of pentalenene synthase complexed with mg2+ ions

PDB Compounds: (B:) pentalenene synthase

SCOPe Domain Sequences for d6wkcb_:

Sequence; same for both SEQRES and ATOM records:

>d6wkcb_ a.128.1.4 (B:) Pentalenene synthase {Streptomyces sp., UC5319 [TaxId: 1931]}
fhiplpgrqspdharaeaeqlawprslglirsdaaaerhlrggyadlasrfyphatgadl
dlgvdlmswfflfddlfdgprgenpedtkqltdqvaaaldgplpdtappiahgfadiwrr
tcegmtpawcarsarhwrnyfdgyvdeaesrfwnapcdsaaqylamrrhtigvqptvdla
eragrfevphrvfdsavmsamlqiavdvnlllndiaslekeeargeqnnmvmilrrehgw
sksrsvshmqnevrarleqylllesclpkvgeiyqldtaerealeryrtdavrtvirgsy
dwh

Timeline for d6wkcb_:

• d6wkcb_ is new in SCOPe 2.07-stable
  
• d6wkcb_ appears in the current release, SCOPe 2.08