Lineage for d6w7ib1 (6w7i B:2-362)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2344488Fold a.128: Terpenoid synthases [48575] (1 superfamily)
    multihelical; core: 8 helices (C-J) are arranged in 2 parallel layers
  4. 2344489Superfamily a.128.1: Terpenoid synthases [48576] (6 families) (S)
    duplication: two metal-binding sites are related by a pseudo dyad that also relates helices C-F to helices G-J
  5. 2344939Family a.128.1.0: automated matches [196408] (1 protein)
    not a true family
  6. 2344940Protein automated matches [196409] (45 species)
    not a true protein
  7. 2344997Species Leishmania major [TaxId:5664] [236738] (6 PDB entries)
  8. 2345001Domain d6w7ib1: 6w7i B:2-362 [392908]
    Other proteins in same PDB: d6w7ia2, d6w7ib2
    automated match to d1yhla_
    complexed with 476, act, ca, ipr, peg; mutant

Details for d6w7ib1

PDB Entry: 6w7i (more details), 2.1 Å

PDB Description: lmfpps mutant t164w in complex with 476a, ipp & ca
PDB Compounds: (B:) farnesyl pyrophosphate synthase

SCOPe Domain Sequences for d6w7ib1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6w7ib1 a.128.1.0 (B:2-362) automated matches {Leishmania major [TaxId: 5664]}
ahmerfqkvyeevqefllgdaekrfemdvhrkgylksmmdttclggkynrglcvvdvaea
makdtqmdaaamervlhdacvcgwmiemlqahflveddimdhsktrrgkpcwylhpgvta
qvaindglillawatqmalhyfadrpflaevlrvfhdvdlttwigqlydvtsmvdsakld
akvahanttdyveytpfnhrrivvyktayytywlplvmgllvsgtlekvdkkathkvamv
mgeyfqvqddvmdcftppeklgkigtdiedakcswlavtflttapaekvaefkanygstd
paavavikqlyteqnllarfeeyekavvaeveqliaaleaqnaafaasvkvlwsktykrq
k

SCOPe Domain Coordinates for d6w7ib1:

Click to download the PDB-style file with coordinates for d6w7ib1.
(The format of our PDB-style files is described here.)

Timeline for d6w7ib1:

View in 3D
Domains from same chain:
(mouse over for more information)
d6w7ib2