Class d: Alpha and beta proteins (a+b) [53931] (334 folds) |
Fold d.58: Ferredoxin-like [54861] (55 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
Superfamily d.58.9: RuBisCO, large subunit, small (N-terminal) domain [54966] (1 family) C-terminal domain is beta/alpha barrel |
Family d.58.9.1: Ribulose 1,5-bisphosphate carboxylase-oxygenase [54967] (1 protein) |
Protein Ribulose 1,5-bisphosphate carboxylase-oxygenase [54968] (12 species) |
Species Rhodospirillum rubrum [TaxId:1085] [54974] (5 PDB entries) |
Domain d5rubb2: 5rub B:2-137 [39289] Other proteins in same PDB: d5ruba1, d5rubb1 |
PDB Entry: 5rub (more details), 1.7 Å
SCOP Domain Sequences for d5rubb2:
Sequence, based on SEQRES records: (download)
>d5rubb2 d.58.9.1 (B:2-137) Ribulose 1,5-bisphosphate carboxylase-oxygenase {Rhodospirillum rubrum [TaxId: 1085]} dqssryvnlalkeedliaggehvlcayimkpkagygyvataahfaaesstgtnvevcttd dftrgvdalvyevdeareltkiaypvalfdrnitdgkamiasfltltmgnnqgmgdveya kmhdfyvpeayralfd
>d5rubb2 d.58.9.1 (B:2-137) Ribulose 1,5-bisphosphate carboxylase-oxygenase {Rhodospirillum rubrum [TaxId: 1085]} dqssryvnlalkeedliaggehvlcayimkpkagygyvataahfaaesstgtrgvdalvy evdeareltkiaypvalfdrnitdgkamiasfltltmgnnqgmgdveyakmhdfyvpeay ralfd
Timeline for d5rubb2: