Lineage for d5rubb2 (5rub B:2-137)

  1. Root: SCOP 1.55
  2. 28523Class d: Alpha and beta proteins (a+b) [53931] (184 folds)
  3. 32366Fold d.58: Ferredoxin-like [54861] (36 superfamilies)
  4. 32762Superfamily d.58.9: RuBisCO, large subunit, small (N-terminal) domain [54966] (1 family) (S)
  5. 32763Family d.58.9.1: Ribulose 1,5-bisphosphate carboxylase-oxygenase [54967] (1 protein)
  6. 32764Protein Ribulose 1,5-bisphosphate carboxylase-oxygenase [54968] (6 species)
  7. 32775Species Rhodospirillum rubrum [TaxId:1085] [54974] (5 PDB entries)
  8. 32777Domain d5rubb2: 5rub B:2-137 [39289]
    Other proteins in same PDB: d5ruba1, d5rubb1

Details for d5rubb2

PDB Entry: 5rub (more details), 1.7 Å

PDB Description: crystallographic refinement and structure of ribulose-1,5-bisphosphate carboxylase from rhodospirillum rubrum at 1.7 angstroms resolution

SCOP Domain Sequences for d5rubb2:

Sequence, based on SEQRES records: (download)

>d5rubb2 d.58.9.1 (B:2-137) Ribulose 1,5-bisphosphate carboxylase-oxygenase {Rhodospirillum rubrum}
dqssryvnlalkeedliaggehvlcayimkpkagygyvataahfaaesstgtnvevcttd
dftrgvdalvyevdeareltkiaypvalfdrnitdgkamiasfltltmgnnqgmgdveya
kmhdfyvpeayralfd

Sequence, based on observed residues (ATOM records): (download)

>d5rubb2 d.58.9.1 (B:2-137) Ribulose 1,5-bisphosphate carboxylase-oxygenase {Rhodospirillum rubrum}
dqssryvnlalkeedliaggehvlcayimkpkagygyvataahfaaesstgtrgvdalvy
evdeareltkiaypvalfdrnitdgkamiasfltltmgnnqgmgdveyakmhdfyvpeay
ralfd

SCOP Domain Coordinates for d5rubb2:

Click to download the PDB-style file with coordinates for d5rubb2.
(The format of our PDB-style files is described here.)

Timeline for d5rubb2:

View in 3D
Domains from same chain:
(mouse over for more information)
d5rubb1