SCOPe 2.07: Domain d6w7va1: 6w7v A:5-146

Lineage for d6w7va1 (6w7v A:5-146)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest

4. Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families)
   duplication contains two domains of this fold

5. Family c.55.1.1: Actin/HSP70 [53068] (8 proteins)

6. Protein Actin [53073] (10 species)

7. Species Rabbit (Oryctolagus cuniculus) [TaxId:9986] [53075] (78 PDB entries)
   Uniprot P02568 ! SQ 02568

8. Domain d6w7va1: 6w7v A:5-146 [392868]
   automated match to d1sqka1
   complexed with atp, ca, edo, lab, tfj

Details for d6w7va1

PDB Entry: 6w7v, 1.7 Å

PDB Description: structure of rabbit actin in complex with truncated analog of mycalolide b

PDB Compounds: (A:) Actin, alpha skeletal muscle

SCOPe Domain Sequences for d6w7va1:

Sequence, based on SEQRES records:

>d6w7va1 c.55.1.1 (A:5-146) Actin {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]}
ttalvcdngsglvkagfagddapravfpsivgrprhqgvmvgmgqkdsyvgdeaqskrgi
ltlkypiehgiitnwddmekiwhhtfynelrvapeehptllteaplnpkanrekmtqimf
etfnvpamyvaiqavlslyasg

Sequence, based on observed residues (ATOM records):

>d6w7va1 c.55.1.1 (A:5-146) Actin {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]}
ttalvcdngsglvkagfagddapravfpsivgrprhqdsyvgdeaqskrgiltlkypieh
giitnwddmekiwhhtfynelrvapeehptllteaplnpkanrekmtqimfetfnvpamy
vaiqavlslyasg

Timeline for d6w7va1:

• d6w7va1 is new in SCOPe 2.07-stable
  
• d6w7va1 appears in the current release, SCOPe 2.08