SCOPe 2.07: Domain d6w1ic1: 6w1i C:2-190

Lineage for d6w1ic1 (6w1i C:2-190)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.61: PRTase-like [53270] (1 superfamily)
   core: 3 layers, a/b/a; mixed beta-sheet of 6 strands, order 321456; strand 3 is antiparallel to the rest

4. Superfamily c.61.1: PRTase-like [53271] (3 families)

5. Family c.61.1.1: Phosphoribosyltransferases (PRTases) [53272] (16 proteins)

6. Protein automated matches [190074] (15 species)
   not a true protein

7. Species Bacillus subtilis [TaxId:224308] [261871] (2 PDB entries)

8. Domain d6w1ic1: 6w1i C:2-190 [392850]
   Other proteins in same PDB: d6w1ia2, d6w1ib2, d6w1ic2, d6w1id2
   automated match to d2fxva_
   complexed with g4p, na

Details for d6w1ic1

PDB Entry: 6w1i, 1.8 Å

PDB Description: re-interpretation of ppgpp (g4p) electron density in the deposited crystal structure of xanthine phosphoribosyltransferase (xprt) (1y0b).

PDB Compounds: (C:) Xanthine phosphoribosyltransferase

SCOPe Domain Sequences for d6w1ic1:

Sequence; same for both SEQRES and ATOM records:

>d6w1ic1 c.61.1.1 (C:2-190) automated matches {Bacillus subtilis [TaxId: 224308]}
ealkrkieeegvvlsdqvlkvdsflnhqidpllmqrigdefasrfakdgitkivtiessg
iapavmtglklgvpvvfarkhksltltdnlltasvysftkqtesqiavsgthlsdqdhvl
iiddflangqaahglvsivkqagasiagigivieksfqpgrdelvklgyrveslariqsl
eegkvsfvq

Timeline for d6w1ic1:

• d6w1ic1 is new in SCOPe 2.07-stable
  
• d6w1ic1 appears in the current release, SCOPe 2.08