SCOPe 2.07: Domain d6vidf_: 6vid F:

Lineage for d6vidf_ (6vid F:)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.60: Lipocalins [50813] (1 superfamily)
   barrel, closed or opened; n=8, S=12; meander

4. Superfamily b.60.1: Lipocalins [50814] (10 families)
   bind hydrophobic ligands in their interior

5. Family b.60.1.2: Fatty acid binding protein-like [50847] (18 proteins)
   ten-stranded meander beta-sheet folded upon itself
   relates to the common fold by opening the barrel and insertion of beta-hairpin

6. Protein automated matches [190295] (7 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187133] (101 PDB entries)

8. Domain d6vidf_: 6vid F: [392660]
   automated match to d5u6ga_
   complexed with act, gol

Details for d6vidf_

PDB Entry: 6vid, 2.89 Å

PDB Description: the crystal structure of aps domain-swapped trimer q108k:k40d:t53a:r58l:q38f:q4f variant of hcrbpii

PDB Compounds: (F:) Retinol-binding protein 2

SCOPe Domain Sequences for d6vidf_:

Sequence; same for both SEQRES and ATOM records:

>d6vidf_ b.60.1.2 (F:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
dfngtwemesnenfegymkaldidfatrkiavrltftdvidqdgdnfktkatstflnydv
dftvgvefdeytksldnrhvkalvtwegdvlvcvqkgekenrgwkkwiegdklyleltcg
dqvcrqvfkkk

Timeline for d6vidf_:

• d6vidf_ is new in SCOPe 2.07-stable
  
• d6vidf_ appears in the current release, SCOPe 2.08