Lineage for d6vgjf_ (6vgj F:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2536142Fold d.9: IL8-like [54116] (2 superfamilies)
    beta(3)-alpha
  4. 2536143Superfamily d.9.1: Interleukin 8-like chemokines [54117] (2 families) (S)
    form dimers with different dimerisation modes
  5. 2536552Family d.9.1.0: automated matches [191483] (1 protein)
    not a true family
  6. 2536553Protein automated matches [190775] (3 species)
    not a true protein
  7. 2536554Species Human (Homo sapiens) [TaxId:9606] [188003] (13 PDB entries)
  8. 2536574Domain d6vgjf_: 6vgj F: [392626]
    automated match to d5l7ma_

Details for d6vgjf_

PDB Entry: 6vgj (more details), 2.52 Å

PDB Description: n-terminal variant of cxcl13
PDB Compounds: (F:) C-X-C motif chemokine 13

SCOPe Domain Sequences for d6vgjf_:

Sequence, based on SEQRES records: (download)

>d6vgjf_ d.9.1.0 (F:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
mevyytslrcrcvqessvfiprrfidriqilprgngcprkeiivwkknksivcvdpqaew
iqrmmevlrkrssstlpvpv

Sequence, based on observed residues (ATOM records): (download)

>d6vgjf_ d.9.1.0 (F:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
mevyytslrcrcvqessvfiprrfidriqilprgcprkeiivwkknksivcvdpqaewiq
rmmevlrkrssstpvpv

SCOPe Domain Coordinates for d6vgjf_:

Click to download the PDB-style file with coordinates for d6vgjf_.
(The format of our PDB-style files is described here.)

Timeline for d6vgjf_: