SCOPe 2.07: Domain d6utuh_: 6utu H:

Lineage for d6utuh_ (6utu H:)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.24: Pili subunits [54522] (1 superfamily)
   contains very long N-terminal helix, which end is packed against beta-sheet

4. Superfamily d.24.1: Pili subunits [54523] (8 families)
   bacterial filament proteins

5. Family d.24.1.0: automated matches [233575] (1 protein)
   not a true family

6. Protein automated matches [233576] (3 species)
   not a true protein

7. Species Pseudomonas aeruginosa [TaxId:287] [255339] (5 PDB entries)

8. Domain d6utuh_: 6utu H: [392512]
   automated match to d3njeb_
   complexed with ca

Details for d6utuh_

PDB Entry: 6utu, 2.85 Å

PDB Description: crystal structure of minor pseudopilin ternary complex of xcpvwx from the type 2 secretion system of pseudomonas aeruginosa in the p3 space group

PDB Compounds: (H:) Type II secretion system protein J

SCOPe Domain Sequences for d6utuh_:

Sequence, based on SEQRES records:

>d6utuh_ d.24.1.0 (H:) automated matches {Pseudomonas aeruginosa [TaxId: 287]}
qrmrelvramgalerdltqaverpvrdelgdnrgaflsegendqiveftrggwrnplgqa
rsrlqrvrwslsgetlerrywlvldraqdskprvqqvldgvtalswrfldkehnwqghwp
tdegseeerleslplavemtlehrhygklvrvwrlldppl

Sequence, based on observed residues (ATOM records):

>d6utuh_ d.24.1.0 (H:) automated matches {Pseudomonas aeruginosa [TaxId: 287]}
qrmrelvramgalerdltqaverpvrdelgdnrgaflsegedqiveftrggwrnplgqar
srlqrvrwslsgetlerrywlvldraqdskprvqqvldgvtalswrfldkehnwqghwpt
degseeerleslplavemtlehrhygklvrvwrlldppl

Timeline for d6utuh_:

• d6utuh_ is new in SCOPe 2.07-stable
  
• d6utuh_ appears in the current release, SCOPe 2.08