Class a: All alpha proteins [46456] (289 folds) |
Fold a.104: Cytochrome P450 [48263] (1 superfamily) multihelical |
Superfamily a.104.1: Cytochrome P450 [48264] (2 families) |
Family a.104.1.0: automated matches [191509] (1 protein) not a true family |
Protein automated matches [190847] (95 species) not a true protein |
Species Acanthamoeba castellanii [TaxId:1257118] [391210] (2 PDB entries) |
Domain d6uw2e1: 6uw2 E:43-486 [392477] Other proteins in same PDB: d6uw2a2, d6uw2a3, d6uw2b2, d6uw2b3, d6uw2c2, d6uw2d2, d6uw2d3, d6uw2e2, d6uw2e3, d6uw2f2, d6uw2f3 automated match to d3khma_ complexed with cl6, gai, hem |
PDB Entry: 6uw2 (more details), 2.92 Å
SCOPe Domain Sequences for d6uw2e1:
Sequence; same for both SEQRES and ATOM records: (download)
>d6uw2e1 a.104.1.0 (E:43-486) automated matches {Acanthamoeba castellanii [TaxId: 1257118]} lppvvsslipfvgsglsfaggplqyttdaykkygdiftmkvfgqrltflvgpdahvpffs qgdaelsqdepyqfsvpifgpnvvygadlahrnqqlkfiaaslstkalqsyvplivkeae dffakwdksgtvdirdalaeliiltasrclmgkeirenlftevaklyqtldegllpisvf fpylpipahkrrdearlamvrmfkkiiderranpevkhndclqvfmdaryrgeeqalnde eitglmiallfagqhtssvtgswtglllfeannkkkflpgvleeqeeirkefgdeltmea lnkmdklhrcvkealrmyppllfvmrkvikpfsykdyyvpegdtvfvspalsmrveevfp nadqynperfveedkqaqkyrfvgfgagrhgcmgenfaylqiktiwsvllrnfdielvge lpkpdytamvvgpahpcllrytrk
Timeline for d6uw2e1: