SCOPe 2.07: Domain d6ukvb_: 6ukv B:

Lineage for d6ukvb_ (6ukv B:)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.387: STING C-terminal-like [254119] (1 superfamily)
   5 helices and 5 strands in one mixed beta-sheet, one long bent helix

4. Superfamily d.387.1: STING, TM173 CTD-like [254144] (2 families)
   Pfam PF15009, PubMed 22579474

5. Family d.387.1.1: Tyrosinase cofactor MelC1 [254191] (2 proteins)

6. Protein Tyrosinase cofactor MelC1 [254420] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [254863] (47 PDB entries)

8. Domain d6ukvb_: 6ukv B: [392413]
   automated match to d4f5wa_
   complexed with qb1

Details for d6ukvb_

PDB Entry: 6ukv, 1.83 Å

PDB Description: sting c-terminal domain complexed with non-cyclic dinucleotide compound 9

PDB Compounds: (B:) fusion protein of Ubiquitin-like protein SMT3 and Stimulator of interferon protein c-terminal domain

SCOPe Domain Sequences for d6ukvb_:

Sequence, based on SEQRES records:

>d6ukvb_ d.387.1.1 (B:) Tyrosinase cofactor MelC1 {Human (Homo sapiens) [TaxId: 9606]}
svahglawsyyigylrlilpelqarirtynqhynnllrgavsqrlyillpldcgvpdnls
madpnirfldklpqqtadragikdrvysnsiyellengqragtcvleyatplqtlfamsq
ysqagfsredrleqaklfcqtlediladapesqnncrliayqepaddssfslsqevlrhl
rqe

Sequence, based on observed residues (ATOM records):

>d6ukvb_ d.387.1.1 (B:) Tyrosinase cofactor MelC1 {Human (Homo sapiens) [TaxId: 9606]}
svahglawsyyigylrlilpelqarirtynqhynnllrgavsqrlyillpldcgvpdnls
madpnirfldklpqqtadragikdrvysnsiyellengqragtcvleyatplqtlfamsq
ysqagfsredrleqaklfcqtlediladapesqnncrliayqefslsqevlrhlrqe

Timeline for d6ukvb_:

• d6ukvb_ is new in SCOPe 2.07-stable
  
• d6ukvb_ appears in the current release, SCOPe 2.08