Lineage for d6uk1b_ (6uk1 B:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2473887Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2473888Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) (S)
    division into families based on beta-sheet topologies
  5. 2479613Family c.37.1.0: automated matches [191323] (1 protein)
    not a true family
  6. 2479614Protein automated matches [190123] (156 species)
    not a true protein
  7. 2480081Species Human (Homo sapiens) [TaxId:9606] [186862] (202 PDB entries)
  8. 2480299Domain d6uk1b_: 6uk1 B: [392353]
    automated match to d5x7kb_
    complexed with atp, mg

Details for d6uk1b_

PDB Entry: 6uk1 (more details), 2.69 Å

PDB Description: crystal structure of nucleotide-binding domain 2 (nbd2) of the human cystic fibrosis transmembrane conductance regulator (cftr)
PDB Compounds: (B:) Cystic fibrosis transmembrane conductance regulator

SCOPe Domain Sequences for d6uk1b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6uk1b_ c.37.1.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
diwpsggqmtvkdltakyteggnailenisfsispgqrvgllgrtgsgkstlllaflrll
ntegeiqidgvswdsitleqwrkafgvipqdvfifsgtfrknldpneqwsdqeiwkvade
vglrsvieqfpggldfvlvdggcvlshghkqlmclaravlskakillldepsahldpvty
qiirrtlkqafadctvilcearieamlecdqflvieenkvrqydsiqk

SCOPe Domain Coordinates for d6uk1b_:

Click to download the PDB-style file with coordinates for d6uk1b_.
(The format of our PDB-style files is described here.)

Timeline for d6uk1b_: