SCOPe 2.07: Domain d6uhxb_: 6uhx B:

Lineage for d6uhxb_ (6uhx B:)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
   The nucleotide-binding modes of this and the next two folds/superfamilies are similar

4. Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families)

5. Family c.2.1.0: automated matches [191313] (1 protein)
   not a true family

6. Protein automated matches [190069] (309 species)
   not a true protein

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [232746] (5 PDB entries)

8. Domain d6uhxb_: 6uhx B: [392330]
   automated match to d3kzva_
   complexed with nap

Details for d6uhxb_

PDB Entry: 6uhx, 2.75 Å

PDB Description: crystal structure of yir035c short chain dehydrogenases/reductase from saccharomyces cerevisiae

PDB Compounds: (B:) Uncharacterized oxidoreductase YIR035C

SCOPe Domain Sequences for d6uhxb_:

Sequence; same for both SEQRES and ATOM records:

>d6uhxb_ c.2.1.0 (B:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
mgkvilvtgvsrgigksivdvlfsldkdtvvygvarseaplkklkekygdrffyvvgdit
edsvlkqlvnaavkghgkidslvanagvlepvqnvneidvnawkklydinffsivslvgi
alpelkktngnvvfvssdacnmyfsswgaygsskaalnhfamtlaneerqvkaiavapgi
vdtdmqvnirenvgpssmsaeqlkmfrglkennqlldssvpatvyaklalhgipdgvngq
ylsyndpaladfmp

Timeline for d6uhxb_:

• d6uhxb_ is new in SCOPe 2.07-stable
  
• d6uhxb_ appears in the current release, SCOPe 2.08