Lineage for d6udbc_ (6udb C:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2415300Fold b.61: Streptavidin-like [50875] (8 superfamilies)
    barrel, closed; n=8, S=10; meander
  4. 2415301Superfamily b.61.1: Avidin/streptavidin [50876] (2 families) (S)
  5. 2415302Family b.61.1.1: Avidin/streptavidin [50877] (3 proteins)
  6. 2415640Protein automated matches [190191] (2 species)
    not a true protein
  7. 2415735Species Streptomyces avidinii [TaxId:1895] [189343] (98 PDB entries)
  8. 2415811Domain d6udbc_: 6udb C: [392301]
    automated match to d4ekva_
    complexed with dv7, peg

Details for d6udbc_

PDB Entry: 6udb (more details), 1.55 Å

PDB Description: spectroscopic and structural characterization of a genetically encoded direct sensor for protein-ligand interactions
PDB Compounds: (C:) streptavidin

SCOPe Domain Sequences for d6udbc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6udbc_ b.61.1.1 (C:) automated matches {Streptomyces avidinii [TaxId: 1895]}
agitgtwynqlgstfivtagadgaltgtyesavgnaesryvltgrydsapatdgsgtalg
wtvawknnyrnahsattwsgqyvggaearintqwlxtsgtteanawkstlvghdtftkvk
ps

SCOPe Domain Coordinates for d6udbc_:

Click to download the PDB-style file with coordinates for d6udbc_.
(The format of our PDB-style files is described here.)

Timeline for d6udbc_: