SCOPe 2.07: Domain d3udwa_: 3udw A:

Lineage for d3udwa_ (3udw A:)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (29 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187920] (1626 PDB entries)

8. Domain d3udwa_: 3udw A: [392296]
   automated match to d4gjtb_
   complexed with nag

Details for d3udwa_

PDB Entry: 3udw, 2.9 Å

PDB Description: crystal structure of the immunoreceptor tigit in complex with poliovirus receptor (pvr/cd155/necl-5) d1 domain

PDB Compounds: (A:) T cell immunoreceptor with Ig and ITIM domains

SCOPe Domain Sequences for d3udwa_:

Sequence; same for both SEQRES and ATOM records:

>d3udwa_ b.1.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
mtgtiettgnisaekggsiilqchlssttaqvtqvnweqqdqllaicnadlgwhispsfk
drvapgpglgltlqsltvndtgeyfciyhtypdgtytgriflevl

Timeline for d3udwa_:

• d3udwa_ is new in SCOPe 2.07-stable
  
• d3udwa_ appears in the current release, SCOPe 2.08