SCOPe 2.07: Domain d6uboa1: 6ubo A:20-177

Lineage for d6uboa1 (6ubo A:20-177)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.60: Lipocalins [50813] (1 superfamily)
   barrel, closed or opened; n=8, S=12; meander

4. Superfamily b.60.1: Lipocalins [50814] (10 families)
   bind hydrophobic ligands in their interior

5. Family b.60.1.0: automated matches [191454] (1 protein)
   not a true family

6. Protein automated matches [190698] (25 species)
   not a true protein

7. Species Escherichia coli [TaxId:83333] [392288] (1 PDB entry)

8. Domain d6uboa1: 6ubo A:20-177 [392289]
   Other proteins in same PDB: d6uboa2, d6ubob2
   automated match to d3mbta_
   complexed with cit, p4k, q3j

Details for d6uboa1

PDB Entry: 6ubo, 1.58 Å

PDB Description: fluorogen activating protein dib1

PDB Compounds: (A:) Outer membrane lipoprotein blc

SCOPe Domain Sequences for d6uboa1:

Sequence; same for both SEQRES and ATOM records:

>d6uboa1 b.60.1.0 (A:20-177) automated matches {Escherichia coli [TaxId: 83333]}
ssstpprgvtvvnnfdckrylgtwyeiarfdhrferglekvtatyslrddgglnvinkgy
npdrgmwqqsegkayftgaptraalkvsffgpfyggynvialdreyrhalvcgpdrdylw
insrtptisdevkqemlavatregfdvskfiwvqqpgs

Timeline for d6uboa1:

• d6uboa1 is new in SCOPe 2.07-stable
  
• d6uboa1 appears in the current release, SCOPe 2.08