Lineage for d6tvtd_ (6tvt D:)

  1. Root: SCOPe 2.07
  2. 2643820Class h: Coiled coil proteins [57942] (7 folds)
  3. 2645404Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies)
    core: trimeric coiled coil
  4. 2645405Superfamily h.3.1: Influenza hemagglutinin (stalk) [58064] (2 families) (S)
  5. 2645406Family h.3.1.1: Influenza hemagglutinin (stalk) [58065] (2 proteins)
  6. 2645931Protein automated matches [254646] (36 species)
    not a true protein
  7. 2645957Species Influenza a virus (a/harbour seal/germany/1/2014(h10n7)) [TaxId:1572188] [391914] (10 PDB entries)
  8. 2645965Domain d6tvtd_: 6tvt D: [392254]
    Other proteins in same PDB: d6tvta1, d6tvta2, d6tvtc1, d6tvtc2, d6tvte1, d6tvte2
    automated match to d4d00d_
    complexed with ca, gal, nag, sia; mutant

Details for d6tvtd_

PDB Entry: 6tvt (more details), 2.2 Å

PDB Description: crystal structure of the haemagglutinin mutant (gln226leu, del228) from an h10n7 seal influenza virus isolated in germany in complex with human receptor analogue 6'-sln
PDB Compounds: (D:) hemagglutinin HA2

SCOPe Domain Sequences for d6tvtd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6tvtd_ h.3.1.1 (D:) automated matches {Influenza a virus (a/harbour seal/germany/1/2014(h10n7)) [TaxId: 1572188]}
glfgaiagfiengwegmvdgwygfrhqnaqgtgqaadykstqaaidqitgklnriikktn
tefesiesefseidhqignvinwtkdsitdiwtyqaellvamenqhtidmadsemlnlye
rvrkqlrqnaeedgkgcfeiyhacddscmesirnntydhsqyreeallnrln

SCOPe Domain Coordinates for d6tvtd_:

Click to download the PDB-style file with coordinates for d6tvtd_.
(The format of our PDB-style files is described here.)

Timeline for d6tvtd_: