Class b: All beta proteins [48724] (178 folds) |
Fold b.19: Viral protein domain [49817] (1 superfamily) sandwich; 9 strands in 2 sheets; jelly-roll; form trimers |
Superfamily b.19.1: Viral protein domain [49818] (4 families) forms homotrimers |
Family b.19.1.0: automated matches [227246] (1 protein) not a true family |
Protein automated matches [227017] (57 species) not a true protein |
Species Influenza a virus (a/harbour seal/germany/1/2014(h10n7)) [TaxId:1572188] [391916] (10 PDB entries) |
Domain d6twsa1: 6tws A:1-318 [392244] Other proteins in same PDB: d6twsa2, d6twsb_, d6twsc2, d6twsd_, d6twsg2, d6twsh_ automated match to d3ztna_ complexed with edo, nag; mutant |
PDB Entry: 6tws (more details), 2 Å
SCOPe Domain Sequences for d6twsa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d6twsa1 b.19.1.0 (A:1-318) automated matches {Influenza a virus (a/harbour seal/germany/1/2014(h10n7)) [TaxId: 1572188]} dkiclghhavangtivktltneqeevtnatetvestslnrlcmkgrnhkdlgnchpigml igtpacdlhltgtwdtlierknaiaycypgatvneealrqkimesggiskintgftygss insagttkacmrnggnsfyaelkwlvsknkgqnfpqttntyrnadtaehlimwgihhpss tqekndlygtqslsisvgsstyknnfvpvvgarpqvnglssridfhwtlvqpgdkitfsh nggliapsrvskligrglgiqseapidnsceskcfwrggsintrlpfqnlsprtvgqcpk yvnkkslmlatgmrnvpe
Timeline for d6twsa1: