Lineage for d1f9fa_ (1f9f A:)

  1. Root: SCOP 1.55
  2. 28523Class d: Alpha and beta proteins (a+b) [53931] (184 folds)
  3. 32366Fold d.58: Ferredoxin-like [54861] (36 superfamilies)
  4. 32738Superfamily d.58.8: Viral DNA-binding domain [54957] (1 family) (S)
  5. 32739Family d.58.8.1: Viral DNA-binding domain [54958] (2 proteins)
  6. 32746Protein Papillomavirus-1 E2 protein [54959] (4 species)
  7. 32753Species Human papillomavirus type 18 [TaxId:333761] [54963] (1 PDB entry)
  8. 32754Domain d1f9fa_: 1f9f A: [39224]

Details for d1f9fa_

PDB Entry: 1f9f (more details), 1.9 Å

PDB Description: crystal structure of the hpv-18 e2 dna-binding domain

SCOP Domain Sequences for d1f9fa_:

Sequence, based on SEQRES records: (download)

>d1f9fa_ d.58.8.1 (A:) Papillomavirus-1 E2 protein {Human papillomavirus type 18}
hmtpiihlkgdrnslkclryrlrkhsdhyrdisstwhwtgagnektgiltvtyhsetqrt
kflntvaipdsvqilvgymtm

Sequence, based on observed residues (ATOM records): (download)

>d1f9fa_ d.58.8.1 (A:) Papillomavirus-1 E2 protein {Human papillomavirus type 18}
hmtpiihlkgdrnslkclryrlrkhsdhyrdisstwhwektgiltvtyhsetqrtkflnt
vaipdsvqilvgymtm

SCOP Domain Coordinates for d1f9fa_:

Click to download the PDB-style file with coordinates for d1f9fa_.
(The format of our PDB-style files is described here.)

Timeline for d1f9fa_: