Lineage for d6trcd_ (6trc D:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2611448Fold d.187: Photosystem I subunit PsaD [64233] (1 superfamily)
    beta-BETA(2)-beta-alpha-beta(2); antiparallel sheet: order 2134 packed against helix and BETA-hairpin on the same side; irregular C-terminal tail
  4. 2611449Superfamily d.187.1: Photosystem I subunit PsaD [64234] (1 family) (S)
    automatically mapped to Pfam PF02531
  5. 2611450Family d.187.1.1: Photosystem I subunit PsaD [64235] (2 proteins)
  6. 2611451Protein Photosystem I subunit PsaD [64236] (2 species)
  7. 2611454Species Thermosynechococcus elongatus [TaxId:197221] [377957] (4 PDB entries)
  8. 2611457Domain d6trcd_: 6trc D: [392107]
    Other proteins in same PDB: d6trc0_, d6trc1_, d6trc2_, d6trc3_, d6trc5_, d6trc6_, d6trc7_, d6trc8_, d6trca_, d6trcb_, d6trcc_, d6trce_, d6trcf_, d6trci_, d6trcj_, d6trcl_, d6trcm_, d6trcy_
    automated match to d1jb0d_
    complexed with bcr, ca, cl0, cla, lhg, lmg, pqn, sf4

Details for d6trcd_

PDB Entry: 6trc (more details), 2.98 Å

PDB Description: cryo- em structure of the thermosynechococcus elongatus photosystem i in the presence of cytochrome c6
PDB Compounds: (D:) Photosystem I reaction center subunit II

SCOPe Domain Sequences for d6trcd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6trcd_ d.187.1.1 (D:) Photosystem I subunit PsaD {Thermosynechococcus elongatus [TaxId: 197221]}
ttltgqpplyggstggllsaadteekyaitwtspkeqvfemptagaavmregenlvyfar
keqclalaaqqlrprkindykiyrifpdgetvlihpkdgvfpekvnkgreavnsvprsig
qnpnpsqlkftgkkpydp

SCOPe Domain Coordinates for d6trcd_:

Click to download the PDB-style file with coordinates for d6trcd_.
(The format of our PDB-style files is described here.)

Timeline for d6trcd_: