Class h: Coiled coil proteins [57942] (7 folds) |
Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies) core: trimeric coiled coil |
Superfamily h.3.1: Influenza hemagglutinin (stalk) [58064] (2 families) |
Family h.3.1.1: Influenza hemagglutinin (stalk) [58065] (2 proteins) |
Protein automated matches [254646] (36 species) not a true protein |
Species Influenza A virus, different strains [TaxId:11320] [255822] (42 PDB entries) |
Domain d6tvdj_: 6tvd J: [392066] Other proteins in same PDB: d6tvda1, d6tvda2, d6tvdc_, d6tvde_, d6tvdg1, d6tvdg2, d6tvdi_, d6tvdk_ automated match to d4d00d_ complexed with ca, nag |
PDB Entry: 6tvd (more details), 2.7 Å
SCOPe Domain Sequences for d6tvdj_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6tvdj_ h.3.1.1 (J:) automated matches {Influenza A virus, different strains [TaxId: 11320]} glfgaiagfiengwegmvdgwygfrhqnaqgtgqaadykstqaaidqitgklnriikktn tefesiesefseidhqignvinwtkdsitdiwtyqaellvamenqhtidmadsemlnlye rvrkqlrqnaeedgkgcfeiyhacddscmesirnntydhsqyreeallnrln
Timeline for d6tvdj_: