Lineage for d6tvdj_ (6tvd J:)

  1. Root: SCOPe 2.07
  2. 2643820Class h: Coiled coil proteins [57942] (7 folds)
  3. 2645404Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies)
    core: trimeric coiled coil
  4. 2645405Superfamily h.3.1: Influenza hemagglutinin (stalk) [58064] (2 families) (S)
  5. 2645406Family h.3.1.1: Influenza hemagglutinin (stalk) [58065] (2 proteins)
  6. 2645931Protein automated matches [254646] (36 species)
    not a true protein
  7. 2646215Species Influenza A virus, different strains [TaxId:11320] [255822] (42 PDB entries)
  8. 2646273Domain d6tvdj_: 6tvd J: [392066]
    Other proteins in same PDB: d6tvda1, d6tvda2, d6tvdc_, d6tvde_, d6tvdg1, d6tvdg2, d6tvdi_, d6tvdk_
    automated match to d4d00d_
    complexed with ca, nag

Details for d6tvdj_

PDB Entry: 6tvd (more details), 2.7 Å

PDB Description: crystal structure of the haemagglutinin from a h10n7 seal influenza virus isolated in germany in complex with avian receptor analogue, 3'-sln
PDB Compounds: (J:) hemagglutinin HA2

SCOPe Domain Sequences for d6tvdj_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6tvdj_ h.3.1.1 (J:) automated matches {Influenza A virus, different strains [TaxId: 11320]}
glfgaiagfiengwegmvdgwygfrhqnaqgtgqaadykstqaaidqitgklnriikktn
tefesiesefseidhqignvinwtkdsitdiwtyqaellvamenqhtidmadsemlnlye
rvrkqlrqnaeedgkgcfeiyhacddscmesirnntydhsqyreeallnrln

SCOPe Domain Coordinates for d6tvdj_:

Click to download the PDB-style file with coordinates for d6tvdj_.
(The format of our PDB-style files is described here.)

Timeline for d6tvdj_: