Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.10: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix) [52046] (3 superfamilies) 2 curved layers, a/b; parallel beta-sheet; order 1234...N; there are sequence similarities between different superfamilies |
Superfamily c.10.2: L domain-like [52058] (9 families) less regular structure consisting of variable repeats |
Family c.10.2.0: automated matches [191489] (1 protein) not a true family |
Protein automated matches [190787] (14 species) not a true protein |
Species Mouse (Mus musculus) [TaxId:10090] [391940] (1 PDB entry) |
Domain d6tl8d_: 6tl8 D: [391942] automated match to d4cnca_ complexed with nag |
PDB Entry: 6tl8 (more details), 2.8 Å
SCOPe Domain Sequences for d6tl8d_:
Sequence, based on SEQRES records: (download)
>d6tl8d_ c.10.2.0 (D:) automated matches {Mouse (Mus musculus) [TaxId: 10090]} lcplpcvcqnlseslstlcahrgllfvppnvdrrtvelrladnfiqalgppdfrnmtglv dltlsrnaitrigarsfgdleslrslhldgnrlvelgssslrgpvnlqhlilsgnqlgri apgafddfldsledldvsynnlrqvpwagigsmpalhtlnldhnlidalppgvfaqlsql srldltsnrlatlapdplfsrgrdaeaspsplvlsfsgnplhcncellwlrrlarpddle tcaspptlagryfwavpegefscepplia
>d6tl8d_ c.10.2.0 (D:) automated matches {Mouse (Mus musculus) [TaxId: 10090]} lcplpcvcqnlseslstlcahrgllfvppnvdrrtvelrladnfiqalgppdfrnmtglv dltlsrnaitrigarsfgdleslrslhldgnrlvelgssslrgpvnlqhlilsgnqlgri apgafddflledldvsynnlrqvpwagigsmpalhtlnldhnlidalppgvfaqlsqlsr ldltsnrlatlapdplvlsfsgnplhcncellwlrrlarpddletcaspptlagryfwav pegefscepplia
Timeline for d6tl8d_: