Class h: Coiled coil proteins [57942] (7 folds) |
Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies) core: trimeric coiled coil |
Superfamily h.3.1: Influenza hemagglutinin (stalk) [58064] (2 families) |
Family h.3.1.1: Influenza hemagglutinin (stalk) [58065] (2 proteins) |
Protein automated matches [254646] (36 species) not a true protein |
Species Influenza a virus (a/harbour seal/germany/1/2014(h10n7)) [TaxId:1572188] [391914] (10 PDB entries) |
Domain d6tjyd_: 6tjy D: [391926] Other proteins in same PDB: d6tjya1, d6tjya2, d6tjyc1, d6tjyc2, d6tjye1, d6tjye2, d6tjyg1, d6tjyg2, d6tjyi1, d6tjyi2, d6tjyk1, d6tjyk2 automated match to d4d00d_ complexed with ca, nag |
PDB Entry: 6tjy (more details), 2.82 Å
SCOPe Domain Sequences for d6tjyd_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6tjyd_ h.3.1.1 (D:) automated matches {Influenza a virus (a/harbour seal/germany/1/2014(h10n7)) [TaxId: 1572188]} glfgaiagfiengwegmvdgwygfrhqnaqgtgqaadykstqaaidqitgklnriikktn tefesiesefseidhqignvinwtkdsitdiwtyqaellvamenqhtidmadsemlnlye rvrkqlrqnaeedgkgcfeiyhacddscmesirnntydhsqyreeallnrln
Timeline for d6tjyd_: