SCOPe 2.07: Domain d6smyc1: 6smy C:2-163

Lineage for d6smyc1 (6smy C:2-163)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
   The nucleotide-binding modes of this and the next two folds/superfamilies are similar

4. Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families)

5. Family c.2.1.0: automated matches [191313] (1 protein)
   not a true family

6. Protein automated matches [190069] (309 species)
   not a true protein

7. Species Escherichia coli [TaxId:83333] [349042] (4 PDB entries)

8. Domain d6smyc1: 6smy C:2-163 [391787]
   Other proteins in same PDB: d6smya2, d6smyb2, d6smyc2, d6smyd2
   automated match to d3pdua1
   complexed with llq, nad

Details for d6smyc1

PDB Entry: 6smy, 2.45 Å

PDB Description: crystal structure of sla reductase yihu from e. coli with nadh and product dhps

PDB Compounds: (C:) 3-sulfolactaldehyde reductase

SCOPe Domain Sequences for d6smyc1:

Sequence; same for both SEQRES and ATOM records:

>d6smyc1 c.2.1.0 (C:2-163) automated matches {Escherichia coli [TaxId: 83333]}
aaiafiglgqmgspmasnllqqghqlrvfdvnaeavrhlvdkgatpaanpaqaakdaefi
itmlpngdlvrnvlfgengvceglstdalvidmstihplqtdkliadmqakgfsmmdvpv
grtsanaitgtllllaggtaeqveratpilmamgselinagg

Timeline for d6smyc1:

• d6smyc1 is new in SCOPe 2.07-stable
  
• d6smyc1 appears in the current release, SCOPe 2.08