SCOPe 2.07: Domain d6t3jg1: 6t3j G:1-106

Lineage for d6t3jg1 (6t3j G:1-106)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (29 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187920] (1626 PDB entries)

8. Domain d6t3jg1: 6t3j G:1-106 [391752]
   Other proteins in same PDB: d6t3jb2, d6t3jd2, d6t3je1, d6t3je2, d6t3je3, d6t3jg2, d6t3ji2, d6t3jj1, d6t3jj2, d6t3jj3
   automated match to d1dn0a1

Details for d6t3jg1

PDB Entry: 6t3j, 3.05 Å

PDB Description: dual epitope targeting by anti-dr5 antibodies

PDB Compounds: (G:) IgG1-hDR5-01-Light Chain

SCOPe Domain Sequences for d6t3jg1:

Sequence; same for both SEQRES and ATOM records:

>d6t3jg1 b.1.1.0 (G:1-106) automated matches {Human (Homo sapiens) [TaxId: 9606]}
eivmtqspatlsvspgeratlscrasqsisnnlhwyqqkpgqaprllikfasqsitgipa
rfsgsgsgteftltisslqsedfavyycqqgnswpytfgqgtklei

Timeline for d6t3jg1:

• d6t3jg1 is new in SCOPe 2.07-stable
  
• d6t3jg1 appears in the current release, SCOPe 2.08