Class b: All beta proteins [48724] (178 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.0: automated matches [191470] (1 protein) not a true family |
Protein automated matches [190740] (29 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [187920] (1626 PDB entries) |
Domain d6t3jg1: 6t3j G:1-106 [391752] Other proteins in same PDB: d6t3jb2, d6t3jd2, d6t3je1, d6t3je2, d6t3je3, d6t3jg2, d6t3ji2, d6t3jj1, d6t3jj2, d6t3jj3 automated match to d1dn0a1 |
PDB Entry: 6t3j (more details), 3.05 Å
SCOPe Domain Sequences for d6t3jg1:
Sequence; same for both SEQRES and ATOM records: (download)
>d6t3jg1 b.1.1.0 (G:1-106) automated matches {Human (Homo sapiens) [TaxId: 9606]} eivmtqspatlsvspgeratlscrasqsisnnlhwyqqkpgqaprllikfasqsitgipa rfsgsgsgteftltisslqsedfavyycqqgnswpytfgqgtklei
Timeline for d6t3jg1: