SCOPe 2.07: Domain d6swma_: 6swm A:

Lineage for d6swma_ (6swm A:)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.74: Carbonic anhydrase [51068] (1 superfamily)
   single sheet; 10 strands

4. Superfamily b.74.1: Carbonic anhydrase [51069] (2 families)

5. Family b.74.1.1: Carbonic anhydrase [51070] (2 proteins)
   automatically mapped to Pfam PF00194

6. Protein automated matches [190681] (2 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187805] (54 PDB entries)

8. Domain d6swma_: 6swm A: [391708]
   automated match to d3d0na_
   complexed with lvw, zn

Details for d6swma_

PDB Entry: 6swm, 2.77 Å

PDB Description: selenol bound carbonic anhydrase i

PDB Compounds: (A:) Carbonic anhydrase 1

SCOPe Domain Sequences for d6swma_:

Sequence; same for both SEQRES and ATOM records:

>d6swma_ b.74.1.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
wgyddkngpeqwsklypiangnnqspvdiktsetkhdtslkpisvsynpatakeiinvgh
sfhvnfedndnrsvlkggpfsdsyrlfqfhfhwgstnehgsehtvdgvkysaelhvahwn
sakysslaeaaskadglavigvlmkvgeanpklqkvldalqaiktkgkrapftnfdpstl
lpssldfwtypgslthpplyesvtwiickesisvsseqlaqfrsllsnvegdnavpmqhn
nrptqplkgrtvrasf

Timeline for d6swma_:

• d6swma_ is new in SCOPe 2.07-stable
  
• d6swma_ appears in the current release, SCOPe 2.08