Class a: All alpha proteins [46456] (289 folds) |
Fold a.25: Ferritin-like [47239] (6 superfamilies) core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection |
Superfamily a.25.1: Ferritin-like [47240] (10 families) contains bimetal-ion centre in the middle of the bundle |
Family a.25.1.0: automated matches [191307] (1 protein) not a true family |
Protein automated matches [190036] (58 species) not a true protein |
Species Rhodospirillum rubrum [TaxId:1085] [320959] (5 PDB entries) |
Domain d6sv1z1: 6sv1 Z:7-96 [391692] Other proteins in same PDB: d6sv1a2, d6sv1c2, d6sv1d2, d6sv1e2, d6sv1f2, d6sv1g2, d6sv1i2, d6sv1k2, d6sv1s2, d6sv1t2, d6sv1v2, d6sv1w2, d6sv1x2, d6sv1z2 automated match to d1zpyg_ complexed with ca, fe |
PDB Entry: 6sv1 (more details), 2.19 Å
SCOPe Domain Sequences for d6sv1z1:
Sequence; same for both SEQRES and ATOM records: (download)
>d6sv1z1 a.25.1.0 (Z:7-96) automated matches {Rhodospirillum rubrum [TaxId: 1085]} stheplevlkeetvnrhraivsvmeelaavdwydqrvdastdpeltailahnrdeekeha amtlewlrrndakwaehlrtylftegpita
Timeline for d6sv1z1:
View in 3D Domains from other chains: (mouse over for more information) d6sv1a1, d6sv1a2, d6sv1b_, d6sv1c1, d6sv1c2, d6sv1d1, d6sv1d2, d6sv1e1, d6sv1e2, d6sv1f1, d6sv1f2, d6sv1g1, d6sv1g2, d6sv1h_, d6sv1i1, d6sv1i2, d6sv1j_, d6sv1k1, d6sv1k2, d6sv1l_, d6sv1m_, d6sv1n_, d6sv1o_, d6sv1p_, d6sv1q_, d6sv1r_, d6sv1s1, d6sv1s2, d6sv1t1, d6sv1t2, d6sv1u_, d6sv1v1, d6sv1v2, d6sv1w1, d6sv1w2, d6sv1x1, d6sv1x2, d6sv1y_ |