SCOPe 2.07: Domain d6stkb_: 6stk B:

Lineage for d6stkb_ (6stk B:)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.9: IL8-like [54116] (2 superfamilies)
   beta(3)-alpha

4. Superfamily d.9.1: Interleukin 8-like chemokines [54117] (2 families)
   form dimers with different dimerisation modes

5. Family d.9.1.1: Interleukin 8-like chemokines [54118] (25 proteins)

6. Protein RANTES (regulated upon activation, normal T-cell expressed and secreted) [54132] (1 species)
   has different dimerisation mode

7. Species Human (Homo sapiens) [TaxId:9606] [54133] (17 PDB entries)
   Uniprot P13501 25-91

8. Domain d6stkb_: 6stk B: [391600]
   automated match to d1rtoa_
   complexed with act, gol; mutant

Details for d6stkb_

PDB Entry: 6stk, 1.52 Å

PDB Description: crystal structure of the cc-chemokine 5 (ccl5) e66s mutation

PDB Compounds: (B:) c-c motif chemokine 5

SCOPe Domain Sequences for d6stkb_:

Sequence; same for both SEQRES and ATOM records:

>d6stkb_ d.9.1.1 (B:) RANTES (regulated upon activation, normal T-cell expressed and secreted) {Human (Homo sapiens) [TaxId: 9606]}
yssdttpccfayiarplprahikeyfytsgkcsnpavvfvtrknrqvcanpekkwvreyi
nsls

Timeline for d6stkb_:

• d6stkb_ is new in SCOPe 2.07-stable
  
• d6stkb_ appears in the current release, SCOPe 2.08